VIRAL COUNTERMEASURES TO THE HOST INTERFERON RESPONSE
Quick Response Code Reader In Visual Studio .NETUsing Barcode Control SDK for .NET Control to generate, create, read, scan barcode image in VS .NET applications.
1.00E+09
Denso QR Bar Code Generator In VS .NETUsing Barcode drawer for Visual Studio .NET Control to generate, create Denso QR Bar Code image in .NET framework applications.
1.00E+08
Quick Response Code Decoder In Visual Studio .NETUsing Barcode decoder for .NET framework Control to read, scan read, scan image in .NET applications.
1.00E+07
Bar Code Maker In .NET FrameworkUsing Barcode drawer for .NET framework Control to generate, create bar code image in VS .NET applications.
1.00E+06
Barcode Reader In Visual Studio .NETUsing Barcode reader for .NET framework Control to read, scan read, scan image in VS .NET applications.
nose lung brain
Paint QR Code ISO/IEC18004 In Visual C#Using Barcode creation for .NET framework Control to generate, create QR-Code image in VS .NET applications.
1.00E+05
QR Code Printer In .NET FrameworkUsing Barcode generator for ASP.NET Control to generate, create Quick Response Code image in ASP.NET applications.
1.00E+04
Generate Quick Response Code In VB.NETUsing Barcode generation for .NET Control to generate, create QR Code JIS X 0510 image in VS .NET applications.
1.00E+03
Code39 Creation In .NETUsing Barcode drawer for Visual Studio .NET Control to generate, create USS Code 39 image in .NET applications.
1.00E+02 wtVV WR VVdelE3L VVdel26C VVdel83N
Barcode Maker In .NET FrameworkUsing Barcode printer for Visual Studio .NET Control to generate, create bar code image in Visual Studio .NET applications.
FIGURE 15.5 Titers of VV WR in tissues after intranasal inoculation: 4-week-old C57BL/6 mice were infected with 106 pfu of VV WR. Tissues were harvested 5 days postinfection and titered on RK-13 cells.
Draw EAN13 In Visual Studio .NETUsing Barcode creation for .NET Control to generate, create EAN-13 image in Visual Studio .NET applications.
observed with the P63A mutation. Corresponding residues in ADAR1 result in a reduced af nity for Z-DNA. Of the two prolines, the ADAR1 equivalent residue to E3L P63 is more essential for high-af nity Z-DNA binding, therefore reinforcing the correlation of Z-DNA binding with pathogenicity of vaccinia virus. As shown with the Z-DNA binding mutants, what is known about the N terminus of E3L is the requirement of this domain, as well as the C-terminal dsRNA binding domain, in viral pathogenesis. In C57Bl6 mice, wild-type vaccinia virus replicates to high titers in nasal tissue upon intranasal inoculation and then spreads to the lungs and brain (Figure 15.5). Animals apparently die of encephalitis 5 8 days postinfection. Vaccinia virus deleted of E3L or of the dsRNA binding domain replicate poorly in the nasal tissue, no virus is detected in the lungs or brain, and infected animals show no signs of illness. Virus that still encodes the dsRNA domain but is deleted for the N terminus of E3L replicates to wild-type levels in the nasal mucosa but fails to spread. This virus is more pathogenic than a full E3L deletion but is at least 1000-times less pathogenic than wild-type virus. As mentioned before, the dsRNA binding activity associated with E3L is much more well understood. More than 20 functionally distinct proteins containing the conserved dsRNA binding motif have been identi ed.82 Over the years, mutational analysis of E3L and other proteins containing this conserved motif of 65 68 amino acids has revealed many of the residues required for high-af nity binding to
Identcode Drawer In Visual Studio .NETUsing Barcode generator for VS .NET Control to generate, create Identcode image in .NET applications.
THE E3L GENE
GS1 - 13 Generation In C#.NETUsing Barcode encoder for VS .NET Control to generate, create EAN-13 image in VS .NET applications.
PKR-1 VV WR E3L ADAR-1 RNASE III STAUFEN-2 TN RNA BP Consensus
Bar Code Creation In JavaUsing Barcode drawer for Java Control to generate, create bar code image in Java applications.
-FFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILN -NPVTVINEYCQITRRDWSFR-IESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLL -NPISGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAMKAMTILL -QLQEIVQRDRDVL---IEYDILGETGPAHNKAFDAQVIVNGQVLGKGSGRTKKQAEQSAAQFAINKLI -SEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSV-GEFVGEGEGKSKKISKKNAAIAVLEELK -NPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYKTGLGQNKKESRSNAAKLALDELL NP NEYCQ T R F G H P F V I G F A G SKK A AA A LL
Making Code39 In VB.NETUsing Barcode creator for Visual Studio .NET Control to generate, create Code 39 Extended image in .NET applications.
FIGURE 15.6 dsRNA binding domain homology of E3L to select cellular dsRNA binding proteins. PKR: human dsRNA-dependent protein kinase (domain 1); VV WR-E3L: vaccinia virus E3L; ADAR1: human RNA-speci c adenosine deaminase (domain 1); RNase III: Listeria monocytogenes; Staufen-2: human Staufen-2 (domain 2); TN RNA BP: testis nuclear dsRNA binding protein from Mus musculus.
Print Barcode In Visual Studio .NETUsing Barcode generation for ASP.NET Control to generate, create bar code image in ASP.NET applications.
dsRNA. The E3L protein binds dsRNA molecules in a sequence-independent manner with a Kd ~ 7 9 nm.82 The dsRNA binding domain of E3L shares signi cant homology to dsRNA domains identi ed on many cellular proteins (Figure 15.6). This domain on E3L shares the greatest homology with the ADAR protein, followed by the testis nuclear RNA binding protein and PKR. Substitutions at six conserved residues present on the same face of the binding motif, Glu-124, Phe-135, Phe-148, Lys-167, Arg-168, and Lys-171, greatly reduce dsRNA af nity, and are therefore likely part of the RNA binding site.82 Although the structure of E3L has not yet been elucidated, relevance regarding the structure of the E3L dsRNA binding motif can be inferred based on structural data from similar domains present on other proteins. F or PKR, which contains two tandem motifs, the structure reveals a dumb-bell shape with each motif having an a b b b a fold.83 Similar motif folds were demonstrated for Staufen and RNase III.84 86 The dsRNA recognition mechanism involves interactions with the 20 -OH groups present in the minor groove of the RNA duplex and the dsRNA binding domain.87 When bound to the 20 -OH groups through hydrogen bonding, positively charged residues (equivalent to Lys-167 in E3L) likely make electrostatic interactions with the negatively charged phosphate backbone on the RNA duplex. For PKR, the linker region between the dsRNA binding motifs is highly exible, which allows the two motifs to wrap around the RNA duplex for cooperative and high-af nity binding.83 For E3L, two RNA binding motifs are presented after protein dimerization. In recent years, the structure of the dsRNA binding motif complexed with dsRNA has been resolved. The structure reveals that an RNA duplex of 12 16 base pairs is necessary for binding.88,89 Interaction involves recognition of two successive minor grooves and spanning across the intervening major groove on one face of the RNA duplex. This manner of interaction explains the nonsequence-speci c recognition of dsRNA and lack of binding to ssRNA or dsDNA. Of the a b b b a motif, the N terminus of a1 and the loop between b1 and b2 interact with the adjacent minor grooves on the RNA duplex and a2 interacts with the intervening major groove.89,90 Considering corresponding conserved residues in E3L, it is likely that Glu-122 in a1, and Lys-167 and Lys-171 in a2 are involved in direct interaction with the RNA duplex.
Printing Barcode In C#Using Barcode printer for .NET framework Control to generate, create barcode image in .NET framework applications.
Make EAN 128 In JavaUsing Barcode creator for Java Control to generate, create EAN / UCC - 13 image in Java applications.
Creating Data Matrix 2d Barcode In JavaUsing Barcode creation for Java Control to generate, create Data Matrix image in Java applications.